Cohnella sp. LGH: J4772_04475
Help
Entry
J4772_04475 CDS
T10185
Name
(GenBank) carbohydrate ABC transporter permease
KO
K25675
polygalacturonan/rhamnogalacturonan transport system permease protein
Organism
cohl Cohnella sp. LGH
Brite
KEGG Orthology (KO) [BR:
cohl00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
cohl02000
]
J4772_04475
Transporters [BR:
cohl02000
]
ABC transporters, prokaryotic type
Saccharide, polyol, and lipid transporters
Polygalacturonan/rhamnogalacturonan transporter
J4772_04475
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BPD_transp_1
Motif
Other DBs
NCBI-ProteinID:
QTH46436
LinkDB
All DBs
Position
complement(1133550..1134326)
Genome browser
AA seq
258 aa
AA seq
DB search
MYSVSDPKQAMGGGLFLLPRGFALDSYEMLFRNSLIFDAYSNSLFRLFVGTFVNVALTAM
LAYPLSIRRFMGRTPITLLIFFTMLFNGGMIPSYLLVNGLGLVDSLWALIVPSAISAWNF
FIMKNYFQGLPPELEESANIDGASPLRTLLSIILPVSMPVIAAISLFYGVWHWNAYFDAV
LYLHAPDKQILTLFLRSMMNFSATESTRSTSDSMMIANISEESVKMATIIATMLPMLIIY
PFLQKYFVKGVLIGSVKG
NT seq
777 nt
NT seq
+upstream
nt +downstream
nt
atgtattccgttagcgatcctaagcaggcaatgggcggggggctgttcttgctgccgcgg
ggattcgcgctcgattcgtacgaaatgctgtttcgcaattccttgatcttcgatgcctat
tccaactccttgttccggctattcgttgggacattcgtcaacgttgcgctgacggcgatg
ctggcttatccgctgtcgatccgaagattcatgggaaggacgccgattacgctgctcatc
ttcttcacgatgctgttcaacggcggcatgattccgagctatttgctggttaacggcctg
ggacttgtggactcgctgtgggcgttgatcgtaccgtccgcgatcagcgcgtggaacttc
tttattatgaaaaattacttccagggtcttccgccggagctggaggagtcggccaacata
gacggcgcctcgccgcttcgcaccctgttatcgatcattcttccggtatccatgccggta
atcgcagcgatctcgctcttctacggcgtgtggcactggaacgcttacttcgacgcggtg
ctttatctgcatgctccggataagcagattctgacccttttcctgcgatcgatgatgaac
ttcagcgcaaccgaatcgactcgttcgacgagcgattcgatgatgattgccaacatctcg
gaggaatcggtcaagatggccacgattatcgcgacgatgctcccgatgctgatcatttat
ccgtttctgcagaagtacttcgtcaagggggtgctgatcggttcggtgaaagggtaa
DBGET
integrated database retrieval system