Cohnella abietis: KCTCHS21_56290 Help Entry KCTCHS21_56290    CDS       T05979                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism cohn  Cohnella abietis Pathway cohn00190   Oxidative phosphorylation cohn01100   Metabolic pathways Module cohn_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:cohn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     KCTCHS21_56290 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cohn00194]     KCTCHS21_56290 (atpE) Photosynthesis proteins [BR:cohn00194]  Photosystem and electron transport system   F-type ATPase [OT]    KCTCHS21_56290 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  BBI36230 UniProt:  A0A3T1DDM6 LinkDB All DBs Position complement(6363324..6363548) Genome browser AA seq 74 aa AA seqDB search MVYGLLAAAIVFGLGAFGASIGNGMIFSKTIEGISRQPELRGSLQTTAFIGVGLVEALPI ISLVLAFILMGQAE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggtatacggtcttttagcagcagcaattgtttttggtcttggtgcgtttggtgcaagt attggtaacggtatgatcttcagcaaaacaatcgaaggtatttcccgtcagcctgagctt cgtggttctttgcaaacgactgcattcatcggtgttggtctcgttgaggcattgccgatc atctctctagttcttgcgtttatcttgatgggtcaagctgagtag

DBGET integrated database retrieval system