Campylobacter ornithocola: CORN_0294 Help Entry CORN_0294         CDS       T06736                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism coj  Campylobacter ornithocola Pathway coj01100   Metabolic pathways coj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:coj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CORN_0294 (acpP1)    00074 Mycolic acid biosynthesis     CORN_0294 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CORN_0294 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N PP-binding_2 DUF3219 Motif Other DBs NCBI-ProteinID:  QKF56859 LinkDB All DBs Position 267696..267929 Genome browser AA seq 77 aa AA seqDB search MAIFDDVKKVVVEQLSVDEDAVKMESKIIEDLGADSLDVVELVMALEEKFDVEIPDSDAE KLVKIEDVVNYIENLQK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaatttttgatgatgtaaaaaaagtagttgttgagcaacttagcgtagatgaagat gcggttaaaatggaatctaaaattattgaagatttgggtgctgattctttagatgtagtt gaattagttatggctttagaagaaaaatttgatgtagaaattccagacagcgatgctgaa aaattagtaaaaattgaagatgttgttaattatatagaaaatcttcaaaaataa

DBGET integrated database retrieval system