Campylobacter ornithocola: CORN_1386 Help Entry CORN_1386         CDS       T06736                                  Symbol acpP4 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism coj  Campylobacter ornithocola Pathway coj01100   Metabolic pathways coj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:coj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CORN_1386 (acpP4)    00074 Mycolic acid biosynthesis     CORN_1386 (acpP4)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CORN_1386 (acpP4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding RE_LlaJI DUF7080 Ribosomal_L9_C Motif Other DBs NCBI-ProteinID:  QKF57889 LinkDB All DBs Position 1382153..1382383 Genome browser AA seq 76 aa AA seqDB search MQINTQDILEILKDVGVLVDVNTLEFDKPLKDQGVDSLDMANLFLNLQEKYNIEIPMEDA EKLQNIEELLQYIKSK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgcaaattaacactcaagatattttagaaatattaaaagatgttggagttttagtcgat gtcaatacgctagaatttgataaacctttaaaagatcaaggagttgattctttagatatg gcaaatctttttttaaatttacaagaaaaatataatatagaaattcctatggaagatgcg gaaaaactacaaaatattgaagagttattgcaatatataaaatcaaaataa

DBGET integrated database retrieval system