Capnocytophaga sp. oral taxon 323: AM608_06035 Help Entry AM608_06035       CDS       T04076                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism col  Capnocytophaga sp. oral taxon 323 Pathway col01100   Metabolic pathways col01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:col00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AM608_06035    00074 Mycolic acid biosynthesis     AM608_06035   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AM608_06035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ALC97232 LinkDB All DBs Position complement(1412418..1412666) Genome browser AA seq 82 aa AA seqDB search MNRQEIIDLTTRIFVEEFEVEASVIAPEANFRESLGLDSLDYVDLVVLIEQEFGVKLVEA DFKPIVTFNDFYTTLENKVNAR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaacagacaggagattatagaccttactactcgtatttttgttgaggaatttgaagta gaagccagtgtgattgcccctgaggcaaacttccgcgaatcgttaggattagatagcctt gattatgtggatttggtggtgctgattgaacaagaatttggtgtgaaattggtagaagcc gattttaagcctatcgtaaccttcaacgacttttatactaccctagaaaataaagtgaat gcacgctaa

DBGET integrated database retrieval system