Colwellia sp. MT41: CMT41_09780 Help Entry CMT41_09780       CDS       T04159                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism com  Colwellia sp. MT41 Pathway com01100   Metabolic pathways com01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:com00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CMT41_09780    00074 Mycolic acid biosynthesis     CMT41_09780   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CMT41_09780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF5783 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ALO34975 UniProt:  A0A0S2JG61 LinkDB All DBs Position complement(2279129..2279362) Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKITVEQLGVSEAEVKIDSSFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVTANQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtaatatcgaagaacgcgtaaaaaaaatcaccgttgaacaactaggtgttagtgaa gcagaagttaaaattgattcatcatttgttgatgacttaggtgctgattcattagacact gtagaattagttatggcgttagaagaagaatttgatactgaaattcctgacgaagaagct gaaaaaatcactacagttcaagcagcaatcgattacgttactgctaaccagtaa

DBGET integrated database retrieval system