KEGG   Comamonas sp. B21-038: MJ205_00985
Entry
MJ205_00985       CDS       T10658                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
comb  Comamonas sp. B21-038
Pathway
comb00190  Oxidative phosphorylation
comb01100  Metabolic pathways
comb02020  Two-component system
comb04148  Efferocytosis
Module
comb_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:comb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MJ205_00985 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MJ205_00985 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    MJ205_00985 (petA)
Enzymes [BR:comb01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     MJ205_00985 (petA)
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N
Other DBs
NCBI-ProteinID: ULR89507
LinkDB
Position
222967..223563
AA seq 198 aa
MSDSSIDSSKRTWLIASGCAGAVGGVATAVPFVSSFNPSEKAKAAGAAVEVDISDLKPGE
KITAEWRGKPIWILRRTPEQIAELPQLDGQLADPKSERTAYPTPAYAKNETRSIKPEVLV
VIGICTHLGCSPTDKLQPGPQPSLPDDWKGGFLCPCHGSTFDLAGRVFKNKPAPDNLEVP
AHQYLSDTKLLIGEDKKA
NT seq 597 nt   +upstreamnt  +downstreamnt
atgagtgattcttccatcgactccagtaaaaggacgtggctgatagcgtcgggatgcgca
ggtgctgtcggaggagtcgccactgcggttccgtttgtcagctccttcaatccttcagaa
aaggccaaggccgccggcgctgccgttgaagtggatatctcggacctcaagcctggcgag
aaaatcaccgccgaatggcgcggcaagccgatctggatcctgcgccgcacgcctgagcag
atcgccgagctgccccagctcgatggccagctcgccgaccccaagtcggagcgcaccgcc
tatccgacaccggcctacgccaaaaacgaaacccgctccatcaagcccgaggtgctggtc
gtgatcggcatctgcacccacctgggctgctcccccaccgacaagctgcagcccggcccc
cagccttcgctgcccgacgactggaaaggcggctttctctgcccctgccacggctcgacc
tttgacctggccggccgcgtattcaagaacaagcccgcgcccgacaacctcgaagtgcca
gcgcaccagtatctgagcgataccaagctgctgattggcgaagacaaaaaagcataa

DBGET integrated database retrieval system