Comamonas sp. B21-038: MJ205_00985
Help
Entry
MJ205_00985 CDS
T10658
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
comb Comamonas sp. B21-038
Pathway
comb00190
Oxidative phosphorylation
comb01100
Metabolic pathways
comb02020
Two-component system
comb04148
Efferocytosis
Module
comb_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
comb00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
MJ205_00985 (petA)
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
MJ205_00985 (petA)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
MJ205_00985 (petA)
Enzymes [BR:
comb01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
MJ205_00985 (petA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Rieske
UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID:
ULR89507
LinkDB
All DBs
Position
222967..223563
Genome browser
AA seq
198 aa
AA seq
DB search
MSDSSIDSSKRTWLIASGCAGAVGGVATAVPFVSSFNPSEKAKAAGAAVEVDISDLKPGE
KITAEWRGKPIWILRRTPEQIAELPQLDGQLADPKSERTAYPTPAYAKNETRSIKPEVLV
VIGICTHLGCSPTDKLQPGPQPSLPDDWKGGFLCPCHGSTFDLAGRVFKNKPAPDNLEVP
AHQYLSDTKLLIGEDKKA
NT seq
597 nt
NT seq
+upstream
nt +downstream
nt
atgagtgattcttccatcgactccagtaaaaggacgtggctgatagcgtcgggatgcgca
ggtgctgtcggaggagtcgccactgcggttccgtttgtcagctccttcaatccttcagaa
aaggccaaggccgccggcgctgccgttgaagtggatatctcggacctcaagcctggcgag
aaaatcaccgccgaatggcgcggcaagccgatctggatcctgcgccgcacgcctgagcag
atcgccgagctgccccagctcgatggccagctcgccgaccccaagtcggagcgcaccgcc
tatccgacaccggcctacgccaaaaacgaaacccgctccatcaagcccgaggtgctggtc
gtgatcggcatctgcacccacctgggctgctcccccaccgacaagctgcagcccggcccc
cagccttcgctgcccgacgactggaaaggcggctttctctgcccctgccacggctcgacc
tttgacctggccggccgcgtattcaagaacaagcccgcgcccgacaacctcgaagtgcca
gcgcaccagtatctgagcgataccaagctgctgattggcgaagacaaaaaagcataa
DBGET
integrated database retrieval system