Comamonas sp. B21-038: MJ205_02075 Help Entry MJ205_02075       CDS       T10658                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism comb  Comamonas sp. B21-038 Pathway comb01100   Metabolic pathways comb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:comb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MJ205_02075 (acpP)    00074 Mycolic acid biosynthesis     MJ205_02075 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MJ205_02075 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF7127 Phage_terminase Motif Other DBs NCBI-ProteinID:  ULR89708 LinkDB All DBs Position 462734..462973 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFEIEIPDEDA EKITTVQNAIDYANSHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaagaaaatcatcgccgaacaactcggcgtggaagag tctcaagtaacgaacgaaaaggccttcgtggccgacctgggcgctgactcgctggacacc gtggaactggtgatggctttggaagatgagttcgagatcgagatccctgacgaagacgca gagaagatcacgacggtgcagaacgccatcgactacgccaacagccaccaaaaggcttaa

DBGET integrated database retrieval system