Actibacterium sp. EMB200-NS6: TQ29_06475 Help Entry TQ29_06475        CDS       T04096                                  Name (GenBank) prohead protease   KO K03116   sec-independent protein translocase protein TatA Organism con  Actibacterium sp. EMB200-NS6 Pathway con03060   Protein export con03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:con00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TQ29_06475  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     TQ29_06475  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:con02044]     TQ29_06475 Secretion system [BR:con02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    TQ29_06475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF948 Motif Other DBs NCBI-ProteinID:  ALG89907 LinkDB All DBs Position 1310601..1310816 Genome browser AA seq 71 aa AA seqDB search MLNNIGLPGLLLIAVVVLVLFGRGKISSLMGEVGKGITAFKKGVKDGSEEIENNLESARD VTPEATEKDKV NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgctgaacaatatcggccttcccggcctgcttctgatcgccgtcgtggtgctggtgctt ttcggccgcggcaagatttcttcgctgatgggcgaggtcggcaaaggcatcaccgcgttc aagaagggcgtgaaagacggcagcgaagagattgagaacaatctcgaaagcgcacgggat gtcacgcccgaagccaccgaaaaggacaaggtgtaa

DBGET integrated database retrieval system