Actibacterium sp. EMB200-NS6: TQ29_08085 Help Entry TQ29_08085        CDS       T04096                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism con  Actibacterium sp. EMB200-NS6 Pathway con01100   Metabolic pathways con01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:con00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TQ29_08085    00074 Mycolic acid biosynthesis     TQ29_08085   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TQ29_08085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ALG90147 LinkDB All DBs Position 1650662..1650895 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLSVEEDKVIENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFITEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgcagatcgcgtgaaaaagatcgttgtcgaacacctgagcgtggaagaa gacaaggtcatcgaaaacgcgtctttcatcgacgacctgggcgccgacagcctcgacact gtcgaactggtcatggccttcgaggaagagttcggcatcgagatccccgatgacgccgcc gagaccatccagaccttcggcgatgcggtgaagttcatcaccgaagcttcctga

DBGET integrated database retrieval system