KEGG   Coprococcus sp. ART55/1: CCU_10340
Entry
CCU_10340         CDS       T02583                                 
Name
(GenBank) ribosomal protein L18, bacterial type
  KO
K02881  large subunit ribosomal protein L18
Organism
coo  Coprococcus sp. ART55/1
Pathway
coo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:coo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CCU_10340
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:coo03011]
    CCU_10340
Ribosome [BR:coo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CCU_10340
  Bacteria
    CCU_10340
  Archaea
    CCU_10340
SSDB
Motif
Pfam: Ribosomal_L18p DUF7159 RPN11_C
Other DBs
NCBI-ProteinID: CBK82740
LinkDB
Position
1047115..1047366
AA seq 83 aa
MYAQIIDDSVGKTLVAASTTEKAIKDELEKTNDVDAAAYVGKVIAERALEKGIKTVIYDR
GGFVYHGKVQALADAAREAGLEF
NT seq 252 nt   +upstreamnt  +downstreamnt
atgtacgctcagattattgatgattcagttggtaagacattagtagcagcatctacaaca
gagaaggctattaaggatgagcttgagaagacaaatgatgttgatgcagcagcttacgtt
ggtaaggttattgctgagagagcacttgagaagggtatcaagactgttatctatgataga
ggcggtttcgtataccacggtaaggttcaggcattagcagatgcagcgagagaagctggt
ctggaattctag

DBGET integrated database retrieval system