Candida orthopsilosis: CORT_0A07830
Help
Entry
CORT_0A07830 CDS
T02488
Name
(RefSeq) Skp1 subunit D of kinetochore protein complex CBF3
KO
K03094
S-phase kinase-associated protein 1
Organism
cot
Candida orthopsilosis
Pathway
cot03083
Polycomb repressive complex
cot04111
Cell cycle - yeast
cot04120
Ubiquitin mediated proteolysis
cot04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
cot00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
CORT_0A07830
04120 Ubiquitin mediated proteolysis
CORT_0A07830
09126 Chromosome
03083 Polycomb repressive complex
CORT_0A07830
09140 Cellular Processes
09143 Cell growth and death
04111 Cell cycle - yeast
CORT_0A07830
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
cot04131
]
CORT_0A07830
04121 Ubiquitin system [BR:
cot04121
]
CORT_0A07830
03036 Chromosome and associated proteins [BR:
cot03036
]
CORT_0A07830
Membrane trafficking [BR:
cot04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
CORT_0A07830
Ubiquitin system [BR:
cot04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
CORT_0A07830
Cul7 complex
CORT_0A07830
Chromosome and associated proteins [BR:
cot03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
CORT_0A07830
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
CORT_0A07830
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
DehI
Motif
Other DBs
NCBI-GeneID:
14538070
NCBI-ProteinID:
XP_003866608
UniProt:
H8WX29
LinkDB
All DBs
Position
1:1745868..1746362
Genome browser
AA seq
164 aa
AA seq
DB search
MSTPKVILVSSDDEKFPVEQKVAEKSILIKNMINDLNPDGLTEDFEIPTPNVRANVLSKV
LEWCEHHKNTVFQDDEDEDAKRSVPVEEWDRNYLKVDQEMLYEIILAANYLNIKPLLDSG
CKMVAEMIKNKSPEELRKTFNIVNDFSPEEEAAIRKENEWAEDR
NT seq
495 nt
NT seq
+upstream
nt +downstream
nt
atgtctactccaaaagttatcctcgtgtcatcagatgatgagaaattccctgttgaacaa
aaagttgctgaaaaatcaatcttgatcaagaatatgattaatgatttaaacccagatgga
ttaactgaagatttcgaaatccctacccccaatgtacgtgccaatgtcttgtctaaagtc
ttggaatggtgtgaacatcataagaacactgttttccaagatgacgaagatgaagatgcc
aagagatcagtacctgttgaagaatgggatagaaattatttgaaagttgatcaagaaatg
ttgtacgaaattatattggcggctaattatttgaacattaagccattgttggatagtgga
tgtaagatggttgctgaaatgattaagaataagagtcccgaagagttgagaaagactttt
aatattgttaatgatttcagtcctgaagaagaagctgctatcagaaaagagaatgagtgg
gctgaagatagataa
DBGET
integrated database retrieval system