Candida orthopsilosis: CORT_0D03910 Help Entry CORT_0D03910      CDS       T02488                                  Name (RefSeq) Tfb5 protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism cot  Candida orthopsilosis Pathway cot03022   Basal transcription factors cot03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cot00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     CORT_0D03910   09124 Replication and repair    03420 Nucleotide excision repair     CORT_0D03910  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cot03021]     CORT_0D03910    03400 DNA repair and recombination proteins [BR:cot03400]     CORT_0D03910 Transcription machinery [BR:cot03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      CORT_0D03910 DNA repair and recombination proteins [BR:cot03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      CORT_0D03910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tfb5 Binary_toxB_3 Motif Other DBs NCBI-GeneID:  14540266 NCBI-ProteinID:  XP_003869366 UniProt:  H8X5Y3 LinkDB All DBs Position 4:758810..759019 Genome browser AA seq 69 aa AA seqDB search MLVASKGVLVKCDPSIKALIIQIDSVTPGIVLEELDDTHLLIQQDKVDTVKNELNKMLSK NIYNPFEEE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgttagtcgctagtaaaggtgtccttgtgaaatgtgatccatcaataaaggcactcatt attcaaattgactcagttaccccaggcattgtgctagaagaattggacgacacacattta ttaatacaacaagataaagtagatacagtcaaaaatgagttaaacaagatgttgtcgaaa aatatctacaatccgtttgaggaagagtaa

DBGET integrated database retrieval system