Cupriavidus oxalaticus: E0W60_02230 Help Entry E0W60_02230       CDS       T06004                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cox  Cupriavidus oxalaticus Pathway cox00998   Biosynthesis of various antibiotics cox01100   Metabolic pathways cox01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cox00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E0W60_02230    00074 Mycolic acid biosynthesis     E0W60_02230   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E0W60_02230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QBY50060 UniProt:  A0A4P7L458 LinkDB All DBs Position 1:complement(506068..506328) Genome browser AA seq 86 aa AA seqDB search MTELETELARLIIDELDIADLRLEEVTADTPLYGEGFGLDSIDILEIALLVSRKYGVELR SDNPDNKTIFASLGSLAGYVAAQRAS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaccgaacttgaaaccgaactcgcccgcctgatcatcgacgaactcgacatcgcagac ctgcgactggaagaggtcaccgccgacacgccgctgtacggcgaaggcttcgggctggac tccatcgacatcctggagattgccctgctggtgtcgcgcaagtacggggtcgaactgcgt tcggacaaccccgacaacaagaccattttcgcgtcgctcggcagccttgccggctacgtc gcggcgcagcgcgccagctaa

DBGET integrated database retrieval system