Cupriavidus oxalaticus: E0W60_07740 Help Entry E0W60_07740       CDS       T06004                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism cox  Cupriavidus oxalaticus Pathway cox00361   Chlorocyclohexane and chlorobenzene degradation cox00362   Benzoate degradation cox00623   Toluene degradation cox01100   Metabolic pathways cox01120   Microbial metabolism in diverse environments cox01220   Degradation of aromatic compounds Module cox_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:cox00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     E0W60_07740    00361 Chlorocyclohexane and chlorobenzene degradation     E0W60_07740    00623 Toluene degradation     E0W60_07740 Enzymes [BR:cox01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      E0W60_07740     1.14.13.244  phenol 2-monooxygenase (NADH)      E0W60_07740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  QBY51029 UniProt:  A0A4P7LAQ8 LinkDB All DBs Position 1:1727643..1727921 Genome browser AA seq 92 aa AA seqDB search MTTAANVYIALQNNDDTRPIIDAITEANPHAVVSQFPAMVKIDAPGHLTIVRELVAGKLG RDWDLQEIHLNLISLCGNIDEDEDAFTLRWNA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacgaccgctgccaacgtctacatcgccctgcagaacaacgacgacacccgccccatc atcgacgccatcaccgaagccaacccgcacgccgtggtctcgcagttcccggccatggtc aagatcgacgcccccggccacctgaccatcgtgcgcgagctggtcgctggcaagctcggc cgcgactgggacctgcaggagatccacctcaacctgatctcgctgtgcggaaacatcgac gaagacgaagacgccttcacgctgcgctggaacgcctga

DBGET integrated database retrieval system