Cupriavidus oxalaticus: E0W60_07750 Help Entry E0W60_07750       CDS       T06004                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism cox  Cupriavidus oxalaticus Pathway cox00361   Chlorocyclohexane and chlorobenzene degradation cox00362   Benzoate degradation cox00623   Toluene degradation cox01100   Metabolic pathways cox01120   Microbial metabolism in diverse environments cox01220   Degradation of aromatic compounds Module cox_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:cox00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     E0W60_07750    00361 Chlorocyclohexane and chlorobenzene degradation     E0W60_07750    00623 Toluene degradation     E0W60_07750 Enzymes [BR:cox01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      E0W60_07750     1.14.13.244  phenol 2-monooxygenase (NADH)      E0W60_07750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  QBY51031 UniProt:  A0A4P7LGN8 LinkDB All DBs Position 1:1729493..1729852 Genome browser AA seq 119 aa AA seqDB search MPVVSIGDYTFAPADREDAFHGNRLLYIGWDGHLLFCAPHCFPFAPSMPLRAVVQDVLPG VYGYHPDFARIDWSAVQWLRGGQPWQPDLDRTLAENGLGHKDVIRFRTPGLDGIGGSGS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgcccgtcgtatccatcggcgactacaccttcgcgccggccgaccgcgaagacgcgttc cacggcaaccgcctgctctatatcggctgggacggccacctgctgttctgcgcgccgcac tgcttcccgtttgcgccgtcgatgccgctgcgcgcggtggtgcaggacgtgcttcctggc gtctacggctatcacccggacttcgcccgcatcgactggagcgcggtgcagtggctgcgc ggcggccagccgtggcagcccgacctggaccgcacgctggcagagaacggcctgggccac aaggacgtgatccgcttccgcacaccagggctggatggcatcggcggcagcggcagctga

DBGET integrated database retrieval system