Chitinophaga oryzae: HF329_24565 Help Entry HF329_24565       CDS       T07451                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism coy  Chitinophaga oryzae Brite KEGG Orthology (KO) [BR:coy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:coy03032]     HF329_24565    03036 Chromosome and associated proteins [BR:coy03036]     HF329_24565    03400 DNA repair and recombination proteins [BR:coy03400]     HF329_24565 DNA replication proteins [BR:coy03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HF329_24565 Chromosome and associated proteins [BR:coy03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HF329_24565 DNA repair and recombination proteins [BR:coy03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HF329_24565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 HU-DNA_bdg TFIIA_gamma_N Motif Other DBs NCBI-ProteinID:  QJB34292 UniProt:  A0AAE7D9I7 LinkDB All DBs Position 6345004..6345273 Genome browser AA seq 89 aa AA seqDB search MNKAELIDKLAKDAGITKTQANEALDSFTKAVADTLKKGGKVTLVGFGTFSVSKRAARNG RNPQTGQIIKIKAKKVAKFKAGKALSDKL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagccgaattaatcgacaaacttgctaaagacgcaggaatcactaaaacccaa gctaacgaagcgctggactctttcactaaagctgttgctgataccctgaaaaaaggtggt aaagtaacactggtaggtttcggtactttctctgtttctaaacgtgctgcacgtaacggt agaaacccgcagactggccagatcatcaagatcaaagctaagaaagttgctaagttcaaa gctggtaaagctttatccgacaagctctaa

DBGET integrated database retrieval system