Colwellia sp. PAMC 20917: A3Q34_10860 Help Entry A3Q34_10860       CDS       T04511                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism coz  Colwellia sp. PAMC 20917 Pathway coz00290   Valine, leucine and isoleucine biosynthesis coz00650   Butanoate metabolism coz00660   C5-Branched dibasic acid metabolism coz00770   Pantothenate and CoA biosynthesis coz01100   Metabolic pathways coz01110   Biosynthesis of secondary metabolites coz01210   2-Oxocarboxylic acid metabolism coz01230   Biosynthesis of amino acids Module coz_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine coz_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:coz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     A3Q34_10860    00660 C5-Branched dibasic acid metabolism     A3Q34_10860   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     A3Q34_10860   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     A3Q34_10860 Enzymes [BR:coz01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      A3Q34_10860 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ACT_5 ACT_4 ACT_AHAS_ss Motif Other DBs NCBI-ProteinID:  AOW77313 LinkDB All DBs Position 2517624..2517869 Genome browser AA seq 81 aa AA seqDB search MNHYQLRIKADDKQVVLERILQVTRYRGFLIEGIKARVNTGTNIGTIELMVRSERPISLL VDQINKLIDIKDVKVDKNTTK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaaccattatcaattacgtataaaggctgatgataagcaagtggtgttagagcgtatt ttacaagtcacccgctaccgaggcttcctaatcgaaggcattaaggcgcgagttaatacc ggtacaaatatcggcactatagaattaatggtgcgaagtgagcgacctatttcactttta gttgatcaaattaataaactgattgatatcaaagacgtcaaggtagacaaaaataccacg aagtaa

DBGET integrated database retrieval system