Cupriavidus pauculus: EHF44_01060 Help Entry EHF44_01060       CDS       T05738                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism cpau  Cupriavidus pauculus Brite KEGG Orthology (KO) [BR:cpau00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cpau03032]     EHF44_01060    03036 Chromosome and associated proteins [BR:cpau03036]     EHF44_01060    03400 DNA repair and recombination proteins [BR:cpau03400]     EHF44_01060 DNA replication proteins [BR:cpau03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EHF44_01060 Chromosome and associated proteins [BR:cpau03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EHF44_01060 DNA repair and recombination proteins [BR:cpau03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EHF44_01060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 DUF2267 Motif Other DBs NCBI-ProteinID:  AZG12099 UniProt:  A0A3G8GVS7 LinkDB All DBs Position unnamed1:178205..178492 Genome browser AA seq 95 aa AA seqDB search MNKAELVAKVAQGCGLTKVAAERALQTVLSAIENEVAAGGEVTIVGFGAFRGVTRAARAA RNPRTGAFVEIPSRTVPTFAPGKGFKDKVVGWKRN NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagcagagttggtggcgaaagtcgcccaaggttgcggtctcacgaaggtcgcc gcagagcgtgcacttcagacggtcttgtcggcgattgagaacgaggtcgccgcgggtggc gaggtgaccattgttggatttggcgcattccgtggggtcacccgcgccgcccgcgccgcg cgaaaccctcgcactggggccttcgtcgagatcccctccaggacggtcccgaccttcgcg cccggcaagggcttcaaggacaaggttgttggctggaagcgcaactag

DBGET integrated database retrieval system