Cupriavidus pauculus: EHF44_04115 Help Entry EHF44_04115       CDS       T05738                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism cpau  Cupriavidus pauculus Brite KEGG Orthology (KO) [BR:cpau00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cpau03110]     EHF44_04115 (grxC) Chaperones and folding catalysts [BR:cpau03110]  Protein folding catalysts   Protein disulfide isomerase    EHF44_04115 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 Thioredoxin_3 DSBA Motif Other DBs NCBI-ProteinID:  AZG12683 UniProt:  A0A3G8GWS5 LinkDB All DBs Position 1:complement(522647..522904) Genome browser AA seq 85 aa AA seqDB search MARVVMYSTVVCPYCQMAERLLKQRGVETIEKILIDREPGKREEMMTRTGRRTVPQIYID DTHVGGFDDLSALDRQGGLVPLLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgtcgtcatgtacagcacggtagtgtgtccctattgccagatggccgagcgc ctgctcaagcagcgcggcgtcgagacgatcgagaagatcctgatcgaccgcgagcccggc aagcgcgaggaaatgatgacccgtacgggtcgtcgcaccgtgccgcagatctatatcgac gacacccacgtgggcggcttcgacgacctctcggcgctggaccgccagggcggcctggtg ccgctgctggccgcctga

DBGET integrated database retrieval system