Cupriavidus pauculus: EHF44_18695 Help Entry EHF44_18695       CDS       T05738                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cpau  Cupriavidus pauculus Pathway cpau00998   Biosynthesis of various antibiotics cpau01100   Metabolic pathways cpau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cpau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EHF44_18695   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EHF44_18695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AZG15508 UniProt:  A0A3G8H4Z1 LinkDB All DBs Position 2:complement(114526..114795) Genome browser AA seq 89 aa AA seqDB search MKALEQEIKELIISSLSLEDVTADDIDPAAPLFIEGLGLDSIDALELGLALQKRYGITMN GDKEAVRARFASVAALAAFVAEQRGQAPA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgaaggcgcttgagcaagaaatcaaggaacttatcatctcgtcgctttccctcgaggac gtgaccgcggatgatatcgacccggcggcgccgctgttcatcgaaggtctcggcctcgat tccatcgacgcgctggagcttggcctggcgctgcagaaacgctatggcatcaccatgaat ggcgacaaggaagcggttcgcgcccgctttgccagcgtggccgcgctggctgccttcgtg gccgaacagcgcgggcaggcgccggcctga

DBGET integrated database retrieval system