Chaetura pelagica (chimney swift): 104386231 Help Entry 104386231         CDS       T08631                                  Name (RefSeq) profilin-3-like   KO K05759   profilin Organism cpea  Chaetura pelagica (chimney swift) Pathway cpea04810   Regulation of actin cytoskeleton cpea05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cpea00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104386231  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104386231  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpea04131]     104386231   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cpea04812]     104386231    04147 Exosome [BR:cpea04147]     104386231 Membrane trafficking [BR:cpea04131]  Others   Actin-binding proteins    Others     104386231 Cytoskeleton proteins [BR:cpea04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104386231 Exosome [BR:cpea04147]  Exosomal proteins   Proteins found in most exosomes    104386231 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104386231 NCBI-ProteinID:  XP_009993106 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MDLSDKKSASVAKPGEFLTAMSPQEVDLDHRPGSENVPANGNHHSQPKCSVTSDNLLLDG HNMMGVRSKGSDSRSICVGKTSKALIFLMSNKEVYGGVLNKNARDMIVGM NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggacctctctgacaaaaagtctgcgtcagtggccaagccaggagagtttctcacagcc atgtcacctcaagaagtggacttggatcacaggccaggatcagaaaatgttcctgctaat gggaatcaccacagccagccaaaatgcagtgtgactagtgacaacctgctgctggatgga cacaacatgatgggtgtcagaagcaaaggcagtgacagcagatctatctgtgttggcaag acctccaaagccctgatcttcctcatgagcaataaggaagtctatggaggagtcctcaac aaaaatgcccgtgatatgattgtgggcatgtaa

DBGET integrated database retrieval system