Chaetura pelagica (chimney swift): 104386246 Help Entry 104386246         CDS       T08631                                  Symbol H3F3A Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism cpea  Chaetura pelagica (chimney swift) Brite KEGG Orthology (KO) [BR:cpea00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cpea03036]     104386246 (H3F3A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpea04147]     104386246 (H3F3A) Chromosome and associated proteins [BR:cpea03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104386246 (H3F3A) Exosome [BR:cpea04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104386246 (H3F3A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  104386246 NCBI-ProteinID:  XP_009993120 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MSPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYL VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtcgccggggactgtggctctccgtgaaatcaggcgctatcaaaaatctaccgaactt ttgatccgcaaacttcccttccaacgtctggtgcgtgaaattgctcaggacttcaaaaca gatctgcgcttccaaagcgctgccatcggtgctttgcaggaggcaagtgaagcctacttg gttggcctgtttgaagataccaacctgtgtgctatccatgccaaacgtgtcacaatcatg ccaaaagatatccagctagcacgccgcatacgtggagagcgtgcctaa

DBGET integrated database retrieval system