Chaetura pelagica (chimney swift): 104387868 Help Entry 104387868         CDS       T08631                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism cpea  Chaetura pelagica (chimney swift) Pathway cpea04137   Mitophagy - animal cpea04140   Autophagy - animal cpea04144   Endocytosis cpea04145   Phagosome cpea04148   Efferocytosis cpea05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cpea00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104387868 (RAB7A)    04145 Phagosome     104387868 (RAB7A)    04140 Autophagy - animal     104387868 (RAB7A)    04137 Mitophagy - animal     104387868 (RAB7A)    04148 Efferocytosis     104387868 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104387868 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpea04131]     104387868 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpea04147]     104387868 (RAB7A)    04031 GTP-binding proteins [BR:cpea04031]     104387868 (RAB7A) Membrane trafficking [BR:cpea04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     104387868 (RAB7A) Exosome [BR:cpea04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104387868 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    104387868 (RAB7A)   Exosomal proteins of colorectal cancer cells    104387868 (RAB7A)   Exosomal proteins of bladder cancer cells    104387868 (RAB7A) GTP-binding proteins [BR:cpea04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     104387868 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_24 AAA_16 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  104387868 NCBI-ProteinID:  XP_009994966 UniProt:  A0A093BD57 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRVKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatcctcggagactctggggtggga aagacatcactcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggtgcagactttctgacaaaagaggtcatggtggatgacaggctagtgacaatgcag atctgggatacagcaggacaagaacgatttcagtctctgggagttgccttctacagagga gcagactgttgtgtgctggtgtttgatgtcacggcccctaacacgttcaaaaccctagac agctggagggacgaatttctcattcaggccagtccaagggatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aacgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gagctttacaatgaattccctgagcccatcaaactagacaagaatgaccgagtcaaggct tctgcagagagctgcagctgctga

DBGET integrated database retrieval system