Chaetura pelagica (chimney swift): 104387899 Help Entry 104387899         CDS       T08631                                  Symbol MYCBP Name (RefSeq) C-Myc-binding protein   KO K25550   c-Myc-binding protein Organism cpea  Chaetura pelagica (chimney swift) Brite KEGG Orthology (KO) [BR:cpea00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cpea03037]     104387899 (MYCBP) Cilium and associated proteins [BR:cpea03037]  Motile cilia and associated proteins   Sperm associated proteins    104387899 (MYCBP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ZapB TSC22 DUF3450 Mis12 HALZ YabA DivIC Motif Other DBs NCBI-GeneID:  104387899 NCBI-ProteinID:  XP_009994996 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MRLMSGYHFIYFCHMLVALYEEPEKPNSALDFLKHHLGASAPENPEIEALQLEVAEMKEK YEAVLEENKKLKAKLAQYEPPQDEKHGE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaggctgatgtctgggtaccattttatttatttctgtcacatgttggtagccttatat gaagagccagagaaaccaaatagtgcactggactttctgaagcatcacctgggagcttca gctcctgagaatccagaaatagaggcacttcaattggaagtggcagagatgaaagaaaaa tatgaagctgtgttggaagaaaataaaaaactgaaagccaagctggctcagtatgaacca cctcaagatgagaagcatggtgaatga

DBGET integrated database retrieval system