Chaetura pelagica (chimney swift): 104389966 Help Entry 104389966         CDS       T08631                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism cpea  Chaetura pelagica (chimney swift) Pathway cpea03082   ATP-dependent chromatin remodeling cpea04217   Necroptosis Brite KEGG Orthology (KO) [BR:cpea00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104389966  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104389966  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cpea03036]     104389966   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpea04147]     104389966 Chromosome and associated proteins [BR:cpea03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104389966 Exosome [BR:cpea04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104389966 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  104389966 NCBI-ProteinID:  XP_009997333 UniProt:  A0A093BEI9 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search GHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKL LGKVTIAQGGVLPNIQAVLLPKKTDSHKAKSK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gggcactacgcggagcgggtgggcgccggcgccccggtgtacctggcggccgtgctggag tacctgacggccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacg cgcatcatcccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctg ctgggcaaggtgaccatcgcgcagggcggggtgctgcccaacatccaggccgtgctgctg cccaagaagaccgacagccacaaggccaagagcaagtga

DBGET integrated database retrieval system