Chaetura pelagica (chimney swift): 104390643 Help Entry 104390643         CDS       T08631                                  Symbol CLDN19 Name (RefSeq) claudin-19   KO K06087   claudin Organism cpea  Chaetura pelagica (chimney swift) Pathway cpea03272   Virion - Hepatitis viruses cpea04382   Cornified envelope formation cpea04514   Cell adhesion molecule (CAM) interaction cpea04530   Tight junction Brite KEGG Orthology (KO) [BR:cpea00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104390643 (CLDN19)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104390643 (CLDN19)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104390643 (CLDN19)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104390643 (CLDN19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cpea03037]     104390643 (CLDN19)    04147 Exosome [BR:cpea04147]     104390643 (CLDN19) Cilium and associated proteins [BR:cpea03037]  Other cilia and associated proteins   Stereociliary proteins    104390643 (CLDN19) Exosome [BR:cpea04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104390643 (CLDN19)   Exosomal proteins of colorectal cancer cells    104390643 (CLDN19) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 CD20 MGS DUF981 DUF7702 SK_channel Peptidase_M50 DUF2207_C DUF202 Motif Other DBs NCBI-GeneID:  104390643 NCBI-ProteinID:  XP_009998123 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MVHIQTSRALMVISLLLGFFGIIVSVVGMKCTKVGEEDPVTKSRIAVAGGILFILSGLCT LAAVSLYATQVTHEFFRESTVPVNARYEFGSRQGHRSSQQPQPPTAREYV NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggttcacatccagacctcccgggccctaatggtgatttctctcctcctgggcttcttc ggcatcatcgtcagcgtggtgggcatgaaatgcaccaaagttggagaagaggatcccgtc accaagagccgcatcgccgttgctggtggcatcctcttcatcctctctggtctgtgcaca ttggccgccgtgtccttgtacgcaacacaggtgacccacgagttcttcagggagagcact gtccccgtcaacgccaggtacgagttcggctcgcggcaagggcaccggtcctcccagcag ccccagccaccaacggcccgggagtacgtctga

DBGET integrated database retrieval system