Chaetura pelagica (chimney swift): 104392985 Help Entry 104392985         CDS       T08631                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism cpea  Chaetura pelagica (chimney swift) Brite KEGG Orthology (KO) [BR:cpea00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cpea03036]     104392985   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpea04147]     104392985 Chromosome and associated proteins [BR:cpea03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104392985 Exosome [BR:cpea04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104392985 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa PAF Motif Other DBs NCBI-GeneID:  104392985 NCBI-ProteinID:  XP_010000733 UniProt:  A0A093BP82 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKARALLTRKLPFQRLVREIAQDFKTDLRFQSSAVMAL QEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggcccgtacgaagcagacggcgcgcaagtcgacgggcgggaaggcgccccgcaagcag ctggccaccaaggcgcgggcgctgctgacccgcaagctgcccttccagcggctggtgcgc gagatcgcgcaggacttcaagaccgacctgcgcttccagagctcggccgtgatggcgctg caggaggcgagcgaggcctacctggtggggctgttcgaggacaccaacctctgcgccatc cacgccaagcgcgtcaccatcatgcccaaggacatccagctggcccggcgcatccgcggc gagcgcgcctga

DBGET integrated database retrieval system