Chaetura pelagica (chimney swift): 104393362 Help Entry 104393362         CDS       T08631                                  Symbol FAM96A Name (RefSeq) MIP18 family protein FAM96A   KO K26403   cytosolic iron-sulfur assembly component 2 Organism cpea  Chaetura pelagica (chimney swift) Brite KEGG Orthology (KO) [BR:cpea00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cpea03036]     104393362 (FAM96A)    03400 DNA repair and recombination proteins [BR:cpea03400]     104393362 (FAM96A) Chromosome and associated proteins [BR:cpea03036]  Eukaryotic type   Centrosome formation proteins    Spindle formation proteins     104393362 (FAM96A) DNA repair and recombination proteins [BR:cpea03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      104393362 (FAM96A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FeS_assembly_P Motif Other DBs NCBI-GeneID:  104393362 NCBI-ProteinID:  XP_010001145 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MCLVNIIRTIRDPEKPNTLEELEVVTESCVQVQEIGEDEYLVIIRFTPTVPHCSLATLIG LCLRIKLQRCLPFRHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLCEIVEQCVT EPD NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgtgtcttgtcaatatcatccgcaccatccgggacccggagaagcccaacaccttggaa gaactggaagtggtaacagagagctgtgtccaagtgcaggaaataggggaagatgaatat ctggtcatcatcaggtttacaccaacagtacctcattgctccttagccactctcattggc ctttgcttaagaataaaacttcagagatgtttgccttttagacacaagctggaaatctac atatctgagggcacacattccactgaagaagacatcaacaagcaaatcaatgacaaagag agagtagcagctgccatggagaaccccaacctgtgtgagatcgtggagcagtgtgttaca gagcctgactag

DBGET integrated database retrieval system