Chaetura pelagica (chimney swift): 104394306 Help Entry 104394306         CDS       T08631                                  Name (RefSeq) insulin   KO K04526   insulin Organism cpea  Chaetura pelagica (chimney swift) Pathway cpea04010   MAPK signaling pathway cpea04068   FoxO signaling pathway cpea04081   Hormone signaling cpea04114   Oocyte meiosis cpea04140   Autophagy - animal cpea04150   mTOR signaling pathway cpea04810   Regulation of actin cytoskeleton cpea04910   Insulin signaling pathway cpea04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cpea00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104394306    04068 FoxO signaling pathway     104394306    04150 mTOR signaling pathway     104394306   09133 Signaling molecules and interaction    04081 Hormone signaling     104394306  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104394306   09143 Cell growth and death    04114 Oocyte meiosis     104394306   09142 Cell motility    04810 Regulation of actin cytoskeleton     104394306  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104394306    04914 Progesterone-mediated oocyte maturation     104394306  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpea04052]     104394306 Cytokines and neuropeptides [BR:cpea04052]  Neuropeptides   Unclassified    104394306 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  104394306 NCBI-ProteinID:  XP_010002178 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSSPGTSQAAVNQHLCGSHLVEALYLVCGERGFFYSPKARRDIEQ PLVSGPLHGEIGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcgctgcctctcctggcccttcttgctctttccagccctggg accagccaagcagctgtgaaccagcacctctgtggctcccacttggtggaggctctttac ctggtgtgtggagagaggggcttcttctattcccccaaagctcgacgagacattgagcag cctctagtgagcggtcccttgcacggtgagataggagagctgcccttccagcaggaggag tttgagaaggtgaaacgagggatcgtggagcaatgctgccacaacacgtgctctctctac cagctggaaaactactgcaactag

DBGET integrated database retrieval system