Chaetura pelagica (chimney swift): 104395923 Help Entry 104395923         CDS       T08631                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism cpea  Chaetura pelagica (chimney swift) Pathway cpea03272   Virion - Hepatitis viruses cpea04382   Cornified envelope formation cpea04514   Cell adhesion molecule (CAM) interaction cpea04530   Tight junction Brite KEGG Orthology (KO) [BR:cpea00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104395923  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104395923  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104395923  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104395923  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cpea03037]     104395923    04147 Exosome [BR:cpea04147]     104395923 Cilium and associated proteins [BR:cpea03037]  Other cilia and associated proteins   Stereociliary proteins    104395923 Exosome [BR:cpea04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104395923   Exosomal proteins of colorectal cancer cells    104395923 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF1634 DUF1218 DUF7937 DUF7541 GPDPase_memb TMEM_230_134 DUF3185 Motif Other DBs NCBI-GeneID:  104395923 NCBI-ProteinID:  XP_010003980 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MLALPQDLQAARAMVVVSIVLAILGTLLAVTGGKCTNCVEDDTAKAKVMILSGIIFIVAG ILILIPISWSANSIIQDFYNPLVTESQKRDLGSSLYVGWAASALLLLGGGILCCTCPPRG EKPYSAKFTAARSLPASNY NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgctggccctgccacaggacctgcaagctgcccgtgccatggtggtcgtgtccattgtc ttggccatcttgggcaccctgctcgctgtgaccggtggcaagtgtaccaactgcgtggag gacgacaccgccaaagccaaggtcatgattctctctggcatcatcttcatcgtcgctggc atccttatcctcatccccatctcttggtcagccaacagcatcatccaggacttctacaac ccgctggtcaccgaatcgcagaaacgggacctggggtcatccctgtacgtgggctgggcg gcctctgcgctcctgctgcttggaggggggatcctctgctgcacctgcccaccccggggc gagaagccctactctgccaagttcacagctgctcgctcgctgccagccagcaactat

DBGET integrated database retrieval system