Chaetura pelagica (chimney swift): 104398076 Help Entry 104398076         CDS       T08631                                  Symbol TMEM218 Name (RefSeq) transmembrane protein 218   KO K26674   transmembrane protein 218 Organism cpea  Chaetura pelagica (chimney swift) Brite KEGG Orthology (KO) [BR:cpea00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cpea03037]     104398076 (TMEM218) Cilium and associated proteins [BR:cpea03037]  Primary cilia and associated proteins   MKS complex    104398076 (TMEM218) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PRA1 Motif Other DBs NCBI-GeneID:  104398076 NCBI-ProteinID:  XP_010006423 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MGALSQPPPTRSVFYFKAQYLHVGSLIVDTYFISRFILLAVMCLIFLGCLFLLLIHHLME PVYAKPLHSS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgggcgccctgtcgcagccgccgccgacgaggtctgttttctattttaaagcccagtac ctgcatgttggctctcttattgtggacacctacttcatcagccgcttcatcctcctggcc gtgatgtgcctgatcttccttgggtgccttttcttgctcctgattcaccacctcatggag ccagtgtatgccaaaccgctccacagcagctag

DBGET integrated database retrieval system