Chlamydia pecorum P787: CPE3_0472 Help Entry CPE3_0472         CDS       T02853                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cpec  Chlamydia pecorum P787 Pathway cpec01100   Metabolic pathways cpec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cpec00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CPE3_0472 (acpP)    00074 Mycolic acid biosynthesis     CPE3_0472 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CPE3_0472 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 TerB Motif Other DBs NCBI-ProteinID:  AGW39814 LinkDB All DBs Position 522377..522616 Genome browser AA seq 79 aa AA seqDB search MSLEDDVRDIIVEQLGVDPSEVTENASFIEDLNADSLDLTELIMTLEEKFNFEISEEEAE KLRTVGDVLLYIQNRQQQQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtttagaagacgatgtaagggatattattgtagaacaactcggcgttgatccaagc gaagttactgagaacgcttcatttattgaagatcttaatgctgatagcttagatttgaca gagttaatcatgactttagaagagaagtttaactttgagatttctgaggaagaagctgaa aaacttcgtactgttggggatgttttgctttacatccaaaatcgtcaacaacaacagtaa

DBGET integrated database retrieval system