Chlorobium phaeobacteroides DSM 266: Cpha266_2493 Help Entry Cpha266_2493      CDS       T00439                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cph  Chlorobium phaeobacteroides DSM 266 Pathway cph01100   Metabolic pathways cph01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cph00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Cpha266_2493    00074 Mycolic acid biosynthesis     Cpha266_2493   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Cpha266_2493 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 HLH Motif Other DBs NCBI-ProteinID:  ABL66481 UniProt:  A1BJA4 LinkDB All DBs Position 2860163..2860399 Genome browser AA seq 78 aa AA seqDB search MTEAQIKEKVYDIIVSKMGVNKDQIKPESKFSDDLGADSLDTVELIMELENEFDVQIPDE DAEKISTVQQAIDYIVKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgactgaagcacagattaaagaaaaggtatacgatatcattgtcagcaaaatgggcgta aacaaagatcagatcaaaccggaatctaagttttccgacgatctcggtgcagattcactc gacaccgttgaactgatcatggaacttgagaacgaatttgacgtacagattccggatgaa gatgcagaaaagatcagtacggtacagcaggctatcgattacatcgtaaagaagtaa

DBGET integrated database retrieval system