Clavibacter phaseoli: FGI33_05075 Help Entry FGI33_05075       CDS       T08435                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cpha  Clavibacter phaseoli Pathway cpha01100   Metabolic pathways cpha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cpha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FGI33_05075    00074 Mycolic acid biosynthesis     FGI33_05075   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FGI33_05075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UKF36493 LinkDB All DBs Position 1097932..1098180 Genome browser AA seq 82 aa AA seqDB search MALSTEEVLAGLAELVNDETGIATDTVEMDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGDAVTFITNAQS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcactgtccaccgaagaagtcctggccggcctggccgagctcgtcaacgacgagacc gggatcgccaccgacaccgtcgagatggacaagtcgttcaccgacgacctggacatcgac tcgatctcgatgatgacgatcgtcgtcaacgccgaggagaagttcgacgtcaagatcccg gacgaggaagtcaagaacctcaagaccgtcggcgacgcggtcacgttcatcaccaacgcg cagtcctga

DBGET integrated database retrieval system