Cnuibacter physcomitrellae: B5808_08675 Help Entry B5808_08675       CDS       T04797                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism cphy  Cnuibacter physcomitrellae Pathway cphy03060   Protein export cphy03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:cphy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     B5808_08675  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     B5808_08675  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cphy02044]     B5808_08675 Secretion system [BR:cphy02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    B5808_08675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ARJ05281 UniProt:  A0A1X9LMW4 LinkDB All DBs Position 1833364..1833654 Genome browser AA seq 96 aa AA seqDB search MGFFQNLTGWHALILLAVVLLLFGAAKLPALARSAGQSMRIFRSEIKDPDASGKHPGEAS EAETETGVVATSPSASAPATRQGRDAAALGGGSASA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgggcttcttccagaacctcacgggatggcacgcgctcatcctcctcgccgtcgtgctg ctgctcttcggcgccgccaagctacccgccctcgcccggagcgccggccagtccatgcgg atcttccgctccgagatcaaggatcccgatgcctcggggaagcacccgggcgaggcgtcc gaggccgagaccgagaccggggtggtcgccacttcgccgtcggcatccgcccccgccacc cggcaggggcgtgacgcggcggcgctgggcggcgggagcgcatccgcatga

DBGET integrated database retrieval system