KEGG   Chrysemys picta (western painted turtle): 101938874
Entry
101938874         CDS       T04662                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
cpic  Chrysemys picta (western painted turtle)
SSDB
Motif
Pfam: MRAP FixQ DUF6097 DUF6709
Other DBs
NCBI-GeneID: 101938874
NCBI-ProteinID: XP_005283970
LinkDB
Position
Unknown
AA seq 123 aa
MAIRTNTSEYYWSYEYYWDYLDPVPVDERKLKANKYSIVIAFWVGIAAFVVFLFLILLYM
SRSGSTPVKQVLAGNRIEHLEGSSSNVERLHCVDLSSPDSDLIATEPCNSLSDEIGIHGS
ISA
NT seq 372 nt   +upstreamnt  +downstreamnt
atggctatcagaacaaacacatctgagtattattggtcttatgaatattactgggactat
ttggatccagttcctgtagatgaaaggaagttgaaggctaataaatattcaattgtcata
gccttttgggttggtattgctgcatttgtggtgtttctgttccttatattgctctacatg
tcccgatctgggtctacaccagtcaaacaagtgcttgcaggtaaccggatagaacatctg
gaaggaagtagctccaatgttgagcggctgcattgtgttgatctcagcagtccagactca
gacttgatcgctactgaaccatgtaattctctttcagatgaaattggcattcatggaagc
atctcggcttga

DBGET integrated database retrieval system