Campylobacter pinnipediorum: CPIN18020_1625 Help Entry CPIN18020_1625    CDS       T05033                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism cpin  Campylobacter pinnipediorum Pathway cpin01100   Metabolic pathways cpin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cpin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CPIN18020_1625    00074 Mycolic acid biosynthesis     CPIN18020_1625   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CPIN18020_1625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 HisKA_2 Motif Other DBs NCBI-ProteinID:  AQW86802 UniProt:  A0A1S6UAI2 LinkDB All DBs Position 1622059..1622277 Genome browser AA seq 72 aa AA seqDB search MNLNNKMELIAELLDLKTSDFKSETILSELDEWDSMAAISYVVMMDEKFGKIIDTKDVKN FKTIQDILDSME NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaatttaaataataaaatggaacttattgctgaattgttagatttaaaaactagcgat tttaaatcagaaactattctaagcgaactagacgaatgggactctatggcagctatatct tatgttgttatgatggatgaaaaatttggaaaaattatagatacgaaagatgttaaaaat ttcaaaacaatacaagacatattagacagcatggaatag

DBGET integrated database retrieval system