Comamonas piscis: HS961_22830
Help
Entry
HS961_22830 CDS
T11249
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
cpis Comamonas piscis
Pathway
cpis03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
cpis00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
HS961_22830 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
cpis03011
]
HS961_22830 (rplR)
Ribosome [BR:
cpis03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
HS961_22830 (rplR)
Bacteria
HS961_22830 (rplR)
Archaea
HS961_22830 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
RIOX1_C_WH
Motif
Other DBs
NCBI-ProteinID:
QMV75436
UniProt:
A0A7G5EN61
LinkDB
All DBs
Position
complement(5051421..5051786)
Genome browser
AA seq
121 aa
AA seq
DB search
MLNKKQQRLRRSLQTRIRIANQGVARLTVNRTNLHIYATIISGDGTKVIATASTAEAEVR
GNLGAAGKGGNTAAATFIGKRIAEKAKAAGVEKVAFDRAGFAYHGRVKALADAAREAGLQ
F
NT seq
366 nt
NT seq
+upstream
nt +downstream
nt
atgttgaacaagaaacagcagcgtcttcgtcgttccctgcaaacccgtatccgcattgcc
aaccaaggcgttgcgcgtttgacggtgaaccgtacgaacctccatatctatgccacgatc
atttctggcgacggcaccaaggtaattgctaccgcatctacggcagaagccgaagtgcgc
ggcaacctgggcgctgccggcaagggtggcaacaccgccgcagctactttcatcggcaag
cgcatcgctgaaaaagcgaaggccgctggcgttgaaaaggttgcattcgaccgtgcaggt
tttgcctaccacggccgcgtcaaggctctggctgatgcagcccgcgaagccggcctgcag
ttctaa
DBGET
integrated database retrieval system