Chlamydia pneumoniae J138: acpS Help Entry acpS              CDS       T00032                                  Symbol acpS Name (GenBank) acyl-carrier protein synthase   KO K00997   holo-[acyl-carrier protein] synthase [EC:2.7.8.7] Organism cpj  Chlamydia pneumoniae J138 Pathway cpj00074   Mycolic acid biosynthesis cpj00770   Pantothenate and CoA biosynthesis cpj01100   Metabolic pathways cpj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cpj00001]  09100 Metabolism   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     acpS (acpS)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     acpS (acpS) Enzymes [BR:cpj01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.8  Transferases for other substituted phosphate groups     2.7.8.7  holo-[acyl-carrier-protein] synthase      acpS (acpS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACPS Motif Other DBs NCBI-ProteinID:  BAA98523 UniProt:  Q9Z8M5 LinkDB All DBs Position 354612..354980 Genome browser AA seq 122 aa AA seqDB search MEIIHIGTDIIEISRIREAIATHGNRLLNRIFTEAEQKYCLEKTDPIPSFAGRFAGKEAV AKALGTGIGSVVAWKDIEVFKVSHGPEVLLPSHVYAKIGISKVILSISHCKEYATATAIA LA NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggaaatcattcatataggaaccgatattattgaaattagccgcattcgcgaggcaatt gcaactcacggcaatcgactactcaatagaatctttacagaagcagaacagaaatattgc ttagaaaagaccgatcccatcccttcatttgcaggtcgctttgctggaaaagaagctgta gcaaaagctttaggaactggcatagggagcgttgttgcctggaaagacatcgaagtcttt aaagtatctcacggacccgaagttctcctcccttcgcatgtctatgcaaaaattggaatt tctaaagtcattctctctataagccactgcaaagagtatgccacagcaactgcaatcgca ttagcctaa

DBGET integrated database retrieval system