Coprothermobacter proteolyticus: COPRO5265_1080 Help Entry COPRO5265_1080    CDS       T00773                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism cpo  Coprothermobacter proteolyticus Pathway cpo00020   Citrate cycle (TCA cycle) cpo00720   Other carbon fixation pathways cpo01100   Metabolic pathways cpo01110   Biosynthesis of secondary metabolites cpo01120   Microbial metabolism in diverse environments cpo01200   Carbon metabolism cpo01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:cpo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     COPRO5265_1080   09102 Energy metabolism    00720 Other carbon fixation pathways     COPRO5265_1080 Enzymes [BR:cpo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      COPRO5265_1080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_10 Fer4_21 Fer4_2 Fer4_9 Fer4_16 Fer4_4 Fer4_15 Fer4_13 Fer4_17 Fer4_8 Fer4_3 Fer4_22 Fer4_18 DUF6438 Motif Other DBs NCBI-ProteinID:  ACI17271 UniProt:  B5Y9E4 LinkDB All DBs Position complement(957007..957219) Genome browser AA seq 70 aa AA seqDB search MANFSVFVDTRLCKSCGLCVMVCPKKVFELRAPDGKSVPVREEDCIGCTQCFNICPDFAI TVFKKEGVQA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt ttggcgaatttttctgtgtttgtggataccaggttgtgtaaatcctgtgggctgtgtgtc atggtgtgcccaaaaaaggtattcgagctaagagctcccgatgggaagagtgtccccgtc agagaagaggattgcatcgggtgcacccagtgttttaacatttgtcctgattttgcaata acggtcttcaagaaagaaggtgttcaagcttga

DBGET integrated database retrieval system