Cavia porcellus (domestic guinea pig): 100135493 Help Entry 100135493         CDS       T07777                                  Symbol Ccl11 Name (RefSeq) eotaxin precursor   KO K16597   C-C motif chemokine 11 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04060   Cytokine-cytokine receptor interaction cpoc04061   Viral protein interaction with cytokine and cytokine receptor cpoc04062   Chemokine signaling pathway cpoc04657   IL-17 signaling pathway cpoc05310   Asthma Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100135493 (Ccl11)    04061 Viral protein interaction with cytokine and cytokine receptor     100135493 (Ccl11)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     100135493 (Ccl11)    04062 Chemokine signaling pathway     100135493 (Ccl11)  09160 Human Diseases   09163 Immune disease    05310 Asthma     100135493 (Ccl11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100135493 (Ccl11) Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Chemokines    100135493 (Ccl11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100135493 NCBI-ProteinID:  NP_001166295 Ensembl:  ENSCPOG00000032138 UniProt:  P80325 LinkDB All DBs AA seq 96 aa AA seqDB search MKVSTAFLCLLLTVSAFSAQVLAHPGIPSACCFRVTNKKISFQRLKSYKIITSSKCPQTA IVFEIKPDKMICADPKKKWVQDAKKYLDQISQTTKP NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaaagtctccacagcgtttctgtgcctgctgctcacagtctctgctttcagcgcccag gtgctcgcccatccaggtatcccaagtgcctgctgctttcgtgtgaccaataagaagatc tcctttcagcgactgaagagctacaaaataatcaccagcagcaaatgtccccagacagcc attgtctttgagatcaaacctgacaaaatgatatgtgcggaccccaagaagaagtgggtt caggatgccaagaagtacctggaccaaatatcccaaactacaaagccgtaa

DBGET integrated database retrieval system