KEGG   Cavia porcellus (domestic guinea pig): 100135584
Entry
100135584         CDS       T07777                                 
Symbol
Nras
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
cpoc  Cavia porcellus (domestic guinea pig)
Pathway
cpoc01521  EGFR tyrosine kinase inhibitor resistance
cpoc01522  Endocrine resistance
cpoc04010  MAPK signaling pathway
cpoc04012  ErbB signaling pathway
cpoc04014  Ras signaling pathway
cpoc04015  Rap1 signaling pathway
cpoc04062  Chemokine signaling pathway
cpoc04068  FoxO signaling pathway
cpoc04071  Sphingolipid signaling pathway
cpoc04072  Phospholipase D signaling pathway
cpoc04137  Mitophagy - animal
cpoc04140  Autophagy - animal
cpoc04150  mTOR signaling pathway
cpoc04151  PI3K-Akt signaling pathway
cpoc04210  Apoptosis
cpoc04211  Longevity regulating pathway
cpoc04213  Longevity regulating pathway - multiple species
cpoc04218  Cellular senescence
cpoc04360  Axon guidance
cpoc04370  VEGF signaling pathway
cpoc04371  Apelin signaling pathway
cpoc04540  Gap junction
cpoc04550  Signaling pathways regulating pluripotency of stem cells
cpoc04625  C-type lectin receptor signaling pathway
cpoc04650  Natural killer cell mediated cytotoxicity
cpoc04660  T cell receptor signaling pathway
cpoc04662  B cell receptor signaling pathway
cpoc04664  Fc epsilon RI signaling pathway
cpoc04714  Thermogenesis
cpoc04720  Long-term potentiation
cpoc04722  Neurotrophin signaling pathway
cpoc04725  Cholinergic synapse
cpoc04726  Serotonergic synapse
cpoc04730  Long-term depression
cpoc04810  Regulation of actin cytoskeleton
cpoc04910  Insulin signaling pathway
cpoc04912  GnRH signaling pathway
cpoc04915  Estrogen signaling pathway
cpoc04916  Melanogenesis
cpoc04917  Prolactin signaling pathway
cpoc04919  Thyroid hormone signaling pathway
cpoc04921  Oxytocin signaling pathway
cpoc04926  Relaxin signaling pathway
cpoc04929  GnRH secretion
cpoc04933  AGE-RAGE signaling pathway in diabetic complications
cpoc04935  Growth hormone synthesis, secretion and action
cpoc05010  Alzheimer disease
cpoc05022  Pathways of neurodegeneration - multiple diseases
cpoc05034  Alcoholism
cpoc05160  Hepatitis C
cpoc05161  Hepatitis B
cpoc05163  Human cytomegalovirus infection
cpoc05165  Human papillomavirus infection
cpoc05166  Human T-cell leukemia virus 1 infection
cpoc05167  Kaposi sarcoma-associated herpesvirus infection
cpoc05170  Human immunodeficiency virus 1 infection
cpoc05200  Pathways in cancer
cpoc05203  Viral carcinogenesis
cpoc05205  Proteoglycans in cancer
cpoc05206  MicroRNAs in cancer
cpoc05207  Chemical carcinogenesis - receptor activation
cpoc05208  Chemical carcinogenesis - reactive oxygen species
cpoc05210  Colorectal cancer
cpoc05211  Renal cell carcinoma
cpoc05213  Endometrial cancer
cpoc05214  Glioma
cpoc05215  Prostate cancer
cpoc05216  Thyroid cancer
cpoc05218  Melanoma
cpoc05219  Bladder cancer
cpoc05220  Chronic myeloid leukemia
cpoc05221  Acute myeloid leukemia
cpoc05223  Non-small cell lung cancer
cpoc05224  Breast cancer
cpoc05225  Hepatocellular carcinoma
cpoc05226  Gastric cancer
cpoc05230  Central carbon metabolism in cancer
cpoc05231  Choline metabolism in cancer
cpoc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cpoc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cpoc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100135584 (Nras)
   04012 ErbB signaling pathway
    100135584 (Nras)
   04014 Ras signaling pathway
    100135584 (Nras)
   04015 Rap1 signaling pathway
    100135584 (Nras)
   04370 VEGF signaling pathway
    100135584 (Nras)
   04371 Apelin signaling pathway
    100135584 (Nras)
   04068 FoxO signaling pathway
    100135584 (Nras)
   04072 Phospholipase D signaling pathway
    100135584 (Nras)
   04071 Sphingolipid signaling pathway
    100135584 (Nras)
   04151 PI3K-Akt signaling pathway
    100135584 (Nras)
   04150 mTOR signaling pathway
    100135584 (Nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100135584 (Nras)
   04137 Mitophagy - animal
    100135584 (Nras)
  09143 Cell growth and death
   04210 Apoptosis
    100135584 (Nras)
   04218 Cellular senescence
    100135584 (Nras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100135584 (Nras)
   04550 Signaling pathways regulating pluripotency of stem cells
    100135584 (Nras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100135584 (Nras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100135584 (Nras)
   04650 Natural killer cell mediated cytotoxicity
    100135584 (Nras)
   04660 T cell receptor signaling pathway
    100135584 (Nras)
   04662 B cell receptor signaling pathway
    100135584 (Nras)
   04664 Fc epsilon RI signaling pathway
    100135584 (Nras)
   04062 Chemokine signaling pathway
    100135584 (Nras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100135584 (Nras)
   04929 GnRH secretion
    100135584 (Nras)
   04912 GnRH signaling pathway
    100135584 (Nras)
   04915 Estrogen signaling pathway
    100135584 (Nras)
   04917 Prolactin signaling pathway
    100135584 (Nras)
   04921 Oxytocin signaling pathway
    100135584 (Nras)
   04926 Relaxin signaling pathway
    100135584 (Nras)
   04935 Growth hormone synthesis, secretion and action
    100135584 (Nras)
   04919 Thyroid hormone signaling pathway
    100135584 (Nras)
   04916 Melanogenesis
    100135584 (Nras)
  09156 Nervous system
   04725 Cholinergic synapse
    100135584 (Nras)
   04726 Serotonergic synapse
    100135584 (Nras)
   04720 Long-term potentiation
    100135584 (Nras)
   04730 Long-term depression
    100135584 (Nras)
   04722 Neurotrophin signaling pathway
    100135584 (Nras)
  09158 Development and regeneration
   04360 Axon guidance
    100135584 (Nras)
  09149 Aging
   04211 Longevity regulating pathway
    100135584 (Nras)
   04213 Longevity regulating pathway - multiple species
    100135584 (Nras)
  09159 Environmental adaptation
   04714 Thermogenesis
    100135584 (Nras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100135584 (Nras)
   05206 MicroRNAs in cancer
    100135584 (Nras)
   05205 Proteoglycans in cancer
    100135584 (Nras)
   05207 Chemical carcinogenesis - receptor activation
    100135584 (Nras)
   05208 Chemical carcinogenesis - reactive oxygen species
    100135584 (Nras)
   05203 Viral carcinogenesis
    100135584 (Nras)
   05230 Central carbon metabolism in cancer
    100135584 (Nras)
   05231 Choline metabolism in cancer
    100135584 (Nras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100135584 (Nras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100135584 (Nras)
   05225 Hepatocellular carcinoma
    100135584 (Nras)
   05226 Gastric cancer
    100135584 (Nras)
   05214 Glioma
    100135584 (Nras)
   05216 Thyroid cancer
    100135584 (Nras)
   05221 Acute myeloid leukemia
    100135584 (Nras)
   05220 Chronic myeloid leukemia
    100135584 (Nras)
   05218 Melanoma
    100135584 (Nras)
   05211 Renal cell carcinoma
    100135584 (Nras)
   05219 Bladder cancer
    100135584 (Nras)
   05215 Prostate cancer
    100135584 (Nras)
   05213 Endometrial cancer
    100135584 (Nras)
   05224 Breast cancer
    100135584 (Nras)
   05223 Non-small cell lung cancer
    100135584 (Nras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100135584 (Nras)
   05170 Human immunodeficiency virus 1 infection
    100135584 (Nras)
   05161 Hepatitis B
    100135584 (Nras)
   05160 Hepatitis C
    100135584 (Nras)
   05163 Human cytomegalovirus infection
    100135584 (Nras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100135584 (Nras)
   05165 Human papillomavirus infection
    100135584 (Nras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100135584 (Nras)
   05022 Pathways of neurodegeneration - multiple diseases
    100135584 (Nras)
  09165 Substance dependence
   05034 Alcoholism
    100135584 (Nras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100135584 (Nras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100135584 (Nras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100135584 (Nras)
   01522 Endocrine resistance
    100135584 (Nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpoc04131]
    100135584 (Nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpoc04147]
    100135584 (Nras)
   04031 GTP-binding proteins [BR:cpoc04031]
    100135584 (Nras)
Membrane trafficking [BR:cpoc04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    100135584 (Nras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100135584 (Nras)
Exosome [BR:cpoc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100135584 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   100135584 (Nras)
  Exosomal proteins of breast cancer cells
   100135584 (Nras)
  Exosomal proteins of colorectal cancer cells
   100135584 (Nras)
GTP-binding proteins [BR:cpoc04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100135584 (Nras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 100135584
NCBI-ProteinID: NP_001166369
Ensembl: ENSCPOG00000021833
UniProt: P12825
LinkDB
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtataaactggtggtggttggagcaggtggtgtcgggaaaagtgcactgacc
atccagctaattcagaaccactttgtcgatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacttgtctgttggatattctggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtgtttgccatcaataatagcaaatcatttgcagatattaacctctacagggagcagatt
aaacgagtaaaagactcagatgatgtacctatggtgctggtagggaacaagtgtgatttg
ccaacaaggactgttgacacaaaacaagcccatgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgcattttacacactcgta
agagaaatacgccagtacagaatgaaaaaactcaacagcaatgatgatgggactcaaggt
tgtatggggttgccatgtgtggtgatgtaa

DBGET integrated database retrieval system