Cavia porcellus (domestic guinea pig): 100135584 Help Entry 100135584         CDS       T07777                                  Symbol Nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc01521   EGFR tyrosine kinase inhibitor resistance cpoc01522   Endocrine resistance cpoc04010   MAPK signaling pathway cpoc04012   ErbB signaling pathway cpoc04014   Ras signaling pathway cpoc04015   Rap1 signaling pathway cpoc04062   Chemokine signaling pathway cpoc04068   FoxO signaling pathway cpoc04071   Sphingolipid signaling pathway cpoc04072   Phospholipase D signaling pathway cpoc04137   Mitophagy - animal cpoc04140   Autophagy - animal cpoc04150   mTOR signaling pathway cpoc04151   PI3K-Akt signaling pathway cpoc04210   Apoptosis cpoc04211   Longevity regulating pathway cpoc04213   Longevity regulating pathway - multiple species cpoc04218   Cellular senescence cpoc04360   Axon guidance cpoc04370   VEGF signaling pathway cpoc04371   Apelin signaling pathway cpoc04540   Gap junction cpoc04550   Signaling pathways regulating pluripotency of stem cells cpoc04625   C-type lectin receptor signaling pathway cpoc04650   Natural killer cell mediated cytotoxicity cpoc04660   T cell receptor signaling pathway cpoc04662   B cell receptor signaling pathway cpoc04664   Fc epsilon RI signaling pathway cpoc04714   Thermogenesis cpoc04720   Long-term potentiation cpoc04722   Neurotrophin signaling pathway cpoc04725   Cholinergic synapse cpoc04726   Serotonergic synapse cpoc04730   Long-term depression cpoc04810   Regulation of actin cytoskeleton cpoc04910   Insulin signaling pathway cpoc04912   GnRH signaling pathway cpoc04915   Estrogen signaling pathway cpoc04916   Melanogenesis cpoc04917   Prolactin signaling pathway cpoc04919   Thyroid hormone signaling pathway cpoc04921   Oxytocin signaling pathway cpoc04926   Relaxin signaling pathway cpoc04929   GnRH secretion cpoc04933   AGE-RAGE signaling pathway in diabetic complications cpoc04935   Growth hormone synthesis, secretion and action cpoc05010   Alzheimer disease cpoc05022   Pathways of neurodegeneration - multiple diseases cpoc05034   Alcoholism cpoc05160   Hepatitis C cpoc05161   Hepatitis B cpoc05163   Human cytomegalovirus infection cpoc05165   Human papillomavirus infection cpoc05166   Human T-cell leukemia virus 1 infection cpoc05167   Kaposi sarcoma-associated herpesvirus infection cpoc05170   Human immunodeficiency virus 1 infection cpoc05200   Pathways in cancer cpoc05203   Viral carcinogenesis cpoc05205   Proteoglycans in cancer cpoc05206   MicroRNAs in cancer cpoc05207   Chemical carcinogenesis - receptor activation cpoc05208   Chemical carcinogenesis - reactive oxygen species cpoc05210   Colorectal cancer cpoc05211   Renal cell carcinoma cpoc05213   Endometrial cancer cpoc05214   Glioma cpoc05215   Prostate cancer cpoc05216   Thyroid cancer cpoc05218   Melanoma cpoc05219   Bladder cancer cpoc05220   Chronic myeloid leukemia cpoc05221   Acute myeloid leukemia cpoc05223   Non-small cell lung cancer cpoc05224   Breast cancer cpoc05225   Hepatocellular carcinoma cpoc05226   Gastric cancer cpoc05230   Central carbon metabolism in cancer cpoc05231   Choline metabolism in cancer cpoc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cpoc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100135584 (Nras)    04012 ErbB signaling pathway     100135584 (Nras)    04014 Ras signaling pathway     100135584 (Nras)    04015 Rap1 signaling pathway     100135584 (Nras)    04370 VEGF signaling pathway     100135584 (Nras)    04371 Apelin signaling pathway     100135584 (Nras)    04068 FoxO signaling pathway     100135584 (Nras)    04072 Phospholipase D signaling pathway     100135584 (Nras)    04071 Sphingolipid signaling pathway     100135584 (Nras)    04151 PI3K-Akt signaling pathway     100135584 (Nras)    04150 mTOR signaling pathway     100135584 (Nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100135584 (Nras)    04137 Mitophagy - animal     100135584 (Nras)   09143 Cell growth and death    04210 Apoptosis     100135584 (Nras)    04218 Cellular senescence     100135584 (Nras)   09144 Cellular community - eukaryotes    04540 Gap junction     100135584 (Nras)    04550 Signaling pathways regulating pluripotency of stem cells     100135584 (Nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100135584 (Nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100135584 (Nras)    04650 Natural killer cell mediated cytotoxicity     100135584 (Nras)    04660 T cell receptor signaling pathway     100135584 (Nras)    04662 B cell receptor signaling pathway     100135584 (Nras)    04664 Fc epsilon RI signaling pathway     100135584 (Nras)    04062 Chemokine signaling pathway     100135584 (Nras)   09152 Endocrine system    04910 Insulin signaling pathway     100135584 (Nras)    04929 GnRH secretion     100135584 (Nras)    04912 GnRH signaling pathway     100135584 (Nras)    04915 Estrogen signaling pathway     100135584 (Nras)    04917 Prolactin signaling pathway     100135584 (Nras)    04921 Oxytocin signaling pathway     100135584 (Nras)    04926 Relaxin signaling pathway     100135584 (Nras)    04935 Growth hormone synthesis, secretion and action     100135584 (Nras)    04919 Thyroid hormone signaling pathway     100135584 (Nras)    04916 Melanogenesis     100135584 (Nras)   09156 Nervous system    04725 Cholinergic synapse     100135584 (Nras)    04726 Serotonergic synapse     100135584 (Nras)    04720 Long-term potentiation     100135584 (Nras)    04730 Long-term depression     100135584 (Nras)    04722 Neurotrophin signaling pathway     100135584 (Nras)   09158 Development and regeneration    04360 Axon guidance     100135584 (Nras)   09149 Aging    04211 Longevity regulating pathway     100135584 (Nras)    04213 Longevity regulating pathway - multiple species     100135584 (Nras)   09159 Environmental adaptation    04714 Thermogenesis     100135584 (Nras)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100135584 (Nras)    05206 MicroRNAs in cancer     100135584 (Nras)    05205 Proteoglycans in cancer     100135584 (Nras)    05207 Chemical carcinogenesis - receptor activation     100135584 (Nras)    05208 Chemical carcinogenesis - reactive oxygen species     100135584 (Nras)    05203 Viral carcinogenesis     100135584 (Nras)    05230 Central carbon metabolism in cancer     100135584 (Nras)    05231 Choline metabolism in cancer     100135584 (Nras)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100135584 (Nras)   09162 Cancer: specific types    05210 Colorectal cancer     100135584 (Nras)    05225 Hepatocellular carcinoma     100135584 (Nras)    05226 Gastric cancer     100135584 (Nras)    05214 Glioma     100135584 (Nras)    05216 Thyroid cancer     100135584 (Nras)    05221 Acute myeloid leukemia     100135584 (Nras)    05220 Chronic myeloid leukemia     100135584 (Nras)    05218 Melanoma     100135584 (Nras)    05211 Renal cell carcinoma     100135584 (Nras)    05219 Bladder cancer     100135584 (Nras)    05215 Prostate cancer     100135584 (Nras)    05213 Endometrial cancer     100135584 (Nras)    05224 Breast cancer     100135584 (Nras)    05223 Non-small cell lung cancer     100135584 (Nras)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100135584 (Nras)    05170 Human immunodeficiency virus 1 infection     100135584 (Nras)    05161 Hepatitis B     100135584 (Nras)    05160 Hepatitis C     100135584 (Nras)    05163 Human cytomegalovirus infection     100135584 (Nras)    05167 Kaposi sarcoma-associated herpesvirus infection     100135584 (Nras)    05165 Human papillomavirus infection     100135584 (Nras)   09164 Neurodegenerative disease    05010 Alzheimer disease     100135584 (Nras)    05022 Pathways of neurodegeneration - multiple diseases     100135584 (Nras)   09165 Substance dependence    05034 Alcoholism     100135584 (Nras)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100135584 (Nras)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100135584 (Nras)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100135584 (Nras)    01522 Endocrine resistance     100135584 (Nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100135584 (Nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100135584 (Nras)    04031 GTP-binding proteins [BR:cpoc04031]     100135584 (Nras) Membrane trafficking [BR:cpoc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100135584 (Nras)  Endocytosis   Macropinocytosis    Ras GTPases     100135584 (Nras) Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100135584 (Nras)   Exosomal proteins of other body fluids (saliva and urine)    100135584 (Nras)   Exosomal proteins of breast cancer cells    100135584 (Nras)   Exosomal proteins of colorectal cancer cells    100135584 (Nras) GTP-binding proteins [BR:cpoc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100135584 (Nras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  100135584 NCBI-ProteinID:  NP_001166369 Ensembl:  ENSCPOG00000021833 UniProt:  P12825 LinkDB All DBs AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataaactggtggtggttggagcaggtggtgtcgggaaaagtgcactgacc atccagctaattcagaaccactttgtcgatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacttgtctgttggatattctggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtgtttgccatcaataatagcaaatcatttgcagatattaacctctacagggagcagatt aaacgagtaaaagactcagatgatgtacctatggtgctggtagggaacaagtgtgatttg ccaacaaggactgttgacacaaaacaagcccatgaactggccaagagttacgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgcattttacacactcgta agagaaatacgccagtacagaatgaaaaaactcaacagcaatgatgatgggactcaaggt tgtatggggttgccatgtgtggtgatgtaa

DBGET integrated database retrieval system