Cavia porcellus (domestic guinea pig): 100379541 Help Entry 100379541         CDS       T07777                                  Symbol Mcpt3 Name (RefSeq) mast cell protease 3 precursor   KO K05509   C-C motif chemokine 7 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04060   Cytokine-cytokine receptor interaction cpoc04061   Viral protein interaction with cytokine and cytokine receptor cpoc04062   Chemokine signaling pathway cpoc04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100379541 (Mcpt3)    04061 Viral protein interaction with cytokine and cytokine receptor     100379541 (Mcpt3)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     100379541 (Mcpt3)    04062 Chemokine signaling pathway     100379541 (Mcpt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100379541 (Mcpt3) Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Chemokines    100379541 (Mcpt3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 SmAKAP LCE6A LolA_2 DUF761 Motif Other DBs NCBI-GeneID:  100379541 NCBI-ProteinID:  NP_001166309 Ensembl:  ENSCPOG00000013035 UniProt:  Q9Z318 LinkDB All DBs AA seq 97 aa AA seqDB search MQVIAVLLCLLLTAANFSSLLLAQPDGVNISTCCYKRSQRIRVQRLESYTRITSSKCPWQ AVIFKTKFNREICADPKQQWVQDSMKYIDKKSKTPKS NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcaagtcattgcagtccttctgtgcctactgctcacagcagccaacttcagctccctt ctgctggctcagccagatggtgttaatatctccacctgctgctataaacggagccagagg attcgggtgcagagactagagagctacacaaggatcaccagcagcaaatgcccctggcaa gctgtgatcttcaagaccaaatttaacagagaaatctgtgctgaccccaaacagcagtgg gtacaggattccatgaagtacatagataagaaatccaaaactccaaagtcttga

DBGET integrated database retrieval system