Cavia porcellus (domestic guinea pig): 100379556 Help Entry 100379556         CDS       T07777                                  Symbol B2m Name (RefSeq) beta-2-microglobulin precursor   KO K08055   beta-2-microglobulin Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04612   Antigen processing and presentation cpoc05163   Human cytomegalovirus infection cpoc05166   Human T-cell leukemia virus 1 infection cpoc05168   Herpes simplex virus 1 infection cpoc05169   Epstein-Barr virus infection cpoc05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:cpoc00001]  09150 Organismal Systems   09151 Immune system    04612 Antigen processing and presentation     100379556 (B2m)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100379556 (B2m)    05170 Human immunodeficiency virus 1 infection     100379556 (B2m)    05168 Herpes simplex virus 1 infection     100379556 (B2m)    05163 Human cytomegalovirus infection     100379556 (B2m)    05169 Epstein-Barr virus infection     100379556 (B2m)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100379556 (B2m) Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of breast milk    100379556 (B2m) SSDB OrthologParalogGFIT Motif Pfam:  C1-set Ig_3 I-set Se-cys_synth_N Ig_2 ig Cna_B Ig_M157 Motif Other DBs NCBI-GeneID:  100379556 NCBI-ProteinID:  NP_001166327 Ensembl:  ENSCPOG00000030414 UniProt:  Q9EQQ1 LinkDB All DBs AA seq 125 aa AA seqDB search MARSVALVSLALLAVLALLSLPAVDAVLHAPRVQVYSRHPAENGKQNFINCYVSGFHPPQ IEVELLKNGKKIDNVEMSDLSFSKDWTFYLLVHAAFTPNDSDEYSCRVSHITLSEPKIVK WDPNK NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggctcgctccgtggccttggtctcgctggccctgctggctgtgctggccctgctgagc ttgccggctgtggacgccgtcctccatgccccaagggttcaagtgtattcccgtcaccca gcagaaaatggaaagcagaatttcatcaactgctatgtatctggattccatccaccccag attgaagtcgaattgctgaagaatgggaagaagatagacaatgtggagatgtcagacctt tctttcagcaaggactggactttctatctcctggtgcatgctgcctttacacccaatgac agtgacgaatattcttgcagagtttcacacatcactctgagtgaacccaagatagtcaaa tgggacccaaacaagtaa

DBGET integrated database retrieval system