Cavia porcellus (domestic guinea pig): 100379579 Help Entry 100379579         CDS       T07777                                  Symbol Ins Name (RefSeq) insulin precursor   KO K04526   insulin Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04010   MAPK signaling pathway cpoc04014   Ras signaling pathway cpoc04015   Rap1 signaling pathway cpoc04022   cGMP-PKG signaling pathway cpoc04066   HIF-1 signaling pathway cpoc04068   FoxO signaling pathway cpoc04072   Phospholipase D signaling pathway cpoc04081   Hormone signaling cpoc04114   Oocyte meiosis cpoc04140   Autophagy - animal cpoc04150   mTOR signaling pathway cpoc04151   PI3K-Akt signaling pathway cpoc04152   AMPK signaling pathway cpoc04211   Longevity regulating pathway cpoc04213   Longevity regulating pathway - multiple species cpoc04810   Regulation of actin cytoskeleton cpoc04910   Insulin signaling pathway cpoc04911   Insulin secretion cpoc04913   Ovarian steroidogenesis cpoc04914   Progesterone-mediated oocyte maturation cpoc04917   Prolactin signaling pathway cpoc04923   Regulation of lipolysis in adipocytes cpoc04930   Type II diabetes mellitus cpoc04931   Insulin resistance cpoc04932   Non-alcoholic fatty liver disease cpoc04940   Type I diabetes mellitus cpoc04950   Maturity onset diabetes of the young cpoc04960   Aldosterone-regulated sodium reabsorption cpoc05010   Alzheimer disease cpoc05215   Prostate cancer cpoc05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100379579 (Ins)    04014 Ras signaling pathway     100379579 (Ins)    04015 Rap1 signaling pathway     100379579 (Ins)    04066 HIF-1 signaling pathway     100379579 (Ins)    04068 FoxO signaling pathway     100379579 (Ins)    04072 Phospholipase D signaling pathway     100379579 (Ins)    04022 cGMP-PKG signaling pathway     100379579 (Ins)    04151 PI3K-Akt signaling pathway     100379579 (Ins)    04152 AMPK signaling pathway     100379579 (Ins)    04150 mTOR signaling pathway     100379579 (Ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     100379579 (Ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100379579 (Ins)   09143 Cell growth and death    04114 Oocyte meiosis     100379579 (Ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100379579 (Ins)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     100379579 (Ins)    04910 Insulin signaling pathway     100379579 (Ins)    04923 Regulation of lipolysis in adipocytes     100379579 (Ins)    04913 Ovarian steroidogenesis     100379579 (Ins)    04914 Progesterone-mediated oocyte maturation     100379579 (Ins)    04917 Prolactin signaling pathway     100379579 (Ins)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100379579 (Ins)   09149 Aging    04211 Longevity regulating pathway     100379579 (Ins)    04213 Longevity regulating pathway - multiple species     100379579 (Ins)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     100379579 (Ins)   09164 Neurodegenerative disease    05010 Alzheimer disease     100379579 (Ins)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     100379579 (Ins)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100379579 (Ins)    04940 Type I diabetes mellitus     100379579 (Ins)    04950 Maturity onset diabetes of the young     100379579 (Ins)    04932 Non-alcoholic fatty liver disease     100379579 (Ins)    04931 Insulin resistance     100379579 (Ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100379579 (Ins) Cytokines and neuropeptides [BR:cpoc04052]  Neuropeptides   Unclassified    100379579 (Ins) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Calc_CGRP_IAPP Motif Other DBs NCBI-GeneID:  100379579 NCBI-ProteinID:  NP_001166362 Ensembl:  ENSCPOG00000031250 UniProt:  P01329 LinkDB All DBs AA seq 110 aa AA seqDB search MALWMHLLTVLALLALWGPNTGQAFVSRHLCGSNLVETLYSVCQDDGFFYIPKDRRELED PQVEQTELGMGLGAGGLQPLALEMALQKRGIVDQCCTGTCTRHQLQSYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggctctgtggatgcatctcctcaccgtgctggccctgctggccctctgggggcccaac actggtcaggcctttgtcagccggcatctgtgcggctccaacttagtggagacattgtat tcagtgtgtcaggatgatggcttcttctatatacccaaggaccgtcgggagctagaggac ccacaggtggagcagacagaactgggcatgggcctgggggcaggtggactacagcccttg gcactggagatggcactacagaagcgtggcattgtggatcagtgctgtactggcacctgc acacgccaccagctgcagagctactgcaactag

DBGET integrated database retrieval system