Cavia porcellus (domestic guinea pig): 100713029 Help Entry 100713029         CDS       T07777                                  Name (RefSeq) glutathione S-transferase A   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc00480   Glutathione metabolism cpoc00980   Metabolism of xenobiotics by cytochrome P450 cpoc00982   Drug metabolism - cytochrome P450 cpoc00983   Drug metabolism - other enzymes cpoc01100   Metabolic pathways cpoc01524   Platinum drug resistance cpoc05200   Pathways in cancer cpoc05204   Chemical carcinogenesis - DNA adducts cpoc05207   Chemical carcinogenesis - receptor activation cpoc05208   Chemical carcinogenesis - reactive oxygen species cpoc05225   Hepatocellular carcinoma cpoc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     100713029   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     100713029    00982 Drug metabolism - cytochrome P450     100713029    00983 Drug metabolism - other enzymes     100713029  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100713029    05204 Chemical carcinogenesis - DNA adducts     100713029    05207 Chemical carcinogenesis - receptor activation     100713029    05208 Chemical carcinogenesis - reactive oxygen species     100713029   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100713029   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100713029   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100713029  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cpoc02000]     100713029 Enzymes [BR:cpoc01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      100713029 Transporters [BR:cpoc02000]  Other transporters   Pores ion channels [TC:1]    100713029 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  100713029 NCBI-ProteinID:  XP_013013573 LinkDB All DBs Position Unknown AA seq 146 aa AA seqDB search MAGKPVLHYFDGRGRMESIRWLLAAAGVEFEEKFITCPEDLEKLRKDGVLMFQQVPMVEM DGMKLVQSRAILNYIATKYNLYGKDTKERLLIDMYTEGVADLYELLLHLIITPPDQKESK MNLIRDKAKNRFLPAFEKVSESAQRL NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggcagggaagccagtacttcactacttcgatggacggggaaggatggagtccatccga tggctcctggctgcagctggggtagagtttgaagagaagtttataacatgtccggaagat ttggaaaagttaagaaaggatggagttctgatgttccagcaagtgcccatggtggagatg gatgggatgaagctggtgcagtccagagccattctcaactacatcgccaccaaatacaac ctctatgggaaagacacgaaggagagactcctgattgatatgtatacagaaggcgtggca gatttatatgaattgctcttacatttgataataactcctccagatcaaaaagagagcaag atgaatttgattagagacaaagcaaagaatcgtttcttacctgcctttgaaaaagtaagt gagtctgctcagcgtttgtga

DBGET integrated database retrieval system