Cavia porcellus (domestic guinea pig): 100713146 Help Entry 100713146         CDS       T07777                                  Symbol Elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04066   HIF-1 signaling pathway cpoc04120   Ubiquitin mediated proteolysis cpoc05170   Human immunodeficiency virus 1 infection cpoc05200   Pathways in cancer cpoc05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:cpoc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100713146 (Elob)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     100713146 (Elob)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100713146 (Elob)   09162 Cancer: specific types    05211 Renal cell carcinoma     100713146 (Elob)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100713146 (Elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cpoc04121]     100713146 (Elob)    03400 DNA repair and recombination proteins [BR:cpoc03400]     100713146 (Elob) Ubiquitin system [BR:cpoc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      100713146 (Elob)    Cul5 complex      100713146 (Elob) DNA repair and recombination proteins [BR:cpoc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100713146 (Elob) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  100713146 NCBI-ProteinID:  XP_003478174 Ensembl:  ENSCPOG00000021024 UniProt:  H0W7H4 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagcaccgtgttcgagctgaagcgcatcgtcgagggcattctcaagcggccgcccgac gagcagagactttacaaggatgaccagctactagatgatggcaaaacgctgggcgagtgt ggttttaccagccagacagcaaggccacaagccccagccacagtgggcctggccttccgg gcagatgacacctttgaggccctacgcattgagcccttctctagcccaccggagcttcca gatgtcatgaagcctcaggactctggaggtagcgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system