Cavia porcellus (domestic guinea pig): 100713514 Help Entry 100713514         CDS       T07777                                  Symbol Dbi Name (RefSeq) acyl-CoA-binding protein   KO K08762   diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc03320   PPAR signaling pathway Brite KEGG Orthology (KO) [BR:cpoc00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     100713514 (Dbi)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100713514 (Dbi) Cytokines and neuropeptides [BR:cpoc04052]  Neuropeptides   Unclassified    100713514 (Dbi) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ACBP CsbD Motif Other DBs NCBI-GeneID:  100713514 NCBI-ProteinID:  XP_003478787 Ensembl:  ENSCPOG00000000415 UniProt:  H0UTW1 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MSQAEFEKAAEEVKHLKTQPTDQEMLFIYSHYKQATVGDINTERPGMLDLKGKAKWDAWN QLKGTAKESAMKAYVDKVEELKNKYGM NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtctcaggctgagtttgagaaagctgctgaggaggttaagcacctcaagacccagcca acagaccaagagatgttgttcatttatagccactacaaacaagccaccgtgggcgacata aatacagaacggcctgggatgttggacctcaaaggcaaagccaagtgggatgcctggaat cagctgaaagggactgccaaagaaagtgccatgaaagcttacgtcgacaaagtagaagag ctaaagaacaaatacggaatgtaa

DBGET integrated database retrieval system