Cavia porcellus (domestic guinea pig): 100714563 Help Entry 100714563         CDS       T07777                                  Symbol Gast Name (RefSeq) gastrin   KO K13768   gastrin Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04081   Hormone signaling cpoc04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     100714563 (Gast)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     100714563 (Gast)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100714563 (Gast) Cytokines and neuropeptides [BR:cpoc04052]  Neuropeptides   GPCR binding    100714563 (Gast) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  100714563 NCBI-ProteinID:  XP_003467161 Ensembl:  ENSCPOG00000009853 UniProt:  H0VFJ4 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MPRLYVCMLAMMLAMAGISKASRRLRSQPKDTSMDPADSRGQPGLMSAHRRQLGPQVPAH LRTDLSKKQGPWAEEEAAYGWMDFGRRSAEDSDQHL NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcccaggctgtatgtgtgcatgctggccatgatgctggccatggctggcatctccaag gcctcccggaggctacgctcccagccgaaggacacatccatggacccggcagacagcagg ggccagccaggcctgatgtctgcccaccggagacagctggggccccaggtccctgcacac ctcaggacagacctgtccaagaagcaggggccatgggcggaggaggaggctgcctacggg tggatggattttggccgccgcagtgcggaggactcagaccagcatctgtag

DBGET integrated database retrieval system